Fork and Spoon Catering | Caterer
Fork and Spoon Catering
Phone: 0410481582
Reviews
to load big map
25.01.2022 Who else is in ????
24.01.2022 Bacon cheeseburger dumplings ...delightful fusion of cultures or culinary train wreck ?? I’m in the delightful fusion camp #cheeseburgerdumplings #forkandspooncatering #dumplingsforlife
23.01.2022 So I was hesitant to post this but after some consideration I have decided to share because I have days when I struggle , I struggle to balance working part time , raising a 6 year old and 6month old , clean and maintain a home and keep fork and spoon running . If you arent aware we are a small family business . I pull all nighters to get prep done and I love what I do but its hard . ... Well this message from this weekends event just made my year . While it is bitter sweet I am so grateful to have been able to play a small part in making their day amazing . To hear feedback like this makes all the long hours and sleepless nights so completely worth it .
23.01.2022 Tonights event was a private dinner party at Bundara Farm such a stunning home and a special way to celebrate a milestone birthday .
22.01.2022 Please help support our fellow foodies ! If your in Melbourne drop in and grab a pie .
21.01.2022 Happy Easter everyone
21.01.2022 Ill be honest I could never be vegan .... or lactose intolerant ....or adhere to a gluten free diet #whencheeseislife
21.01.2022 A little preview of what we do x
20.01.2022 Happy 30th Angela ....now thats a grazing table !
20.01.2022 When you think you are onto a winner and your child will actually eat dinner .... ha ha not a chance ! #nope #whydoievenbothercooking #kidsdontknowwhatgoodfoodis #mychilddoesntcareicanchef @ Tullimbar, New South Wales, Australia
19.01.2022 Some pics from this weekends event . Congratulations to the bride and groom .... the love in the room was so very apparent . @ Malabar, New South Wales, Australia
18.01.2022 Just keep swimming ! For all my Hospo mates today was rough !!! Today was gut wrenching and immensely sad . ... to see people who have poured years of their lives , heart and soul , sacrificed time with friends and family to build their food dream , Have to call it in one way or another was heart breaking . Some have been fortunate and have been able to change direction in order to weather the storm Some have not been so fortunate . Today was a day of complete overwhelming emotion for so many of my peers and we are left wondering what now ??? Only time will tell .....its my greatest hope that we will bounce back bigger and better than before but we just cant predict what this virus will do . So to my friends I say just keep swimming ! Dont give in ! take this time to recharge and reinvent lets turn this negative into a positive and try to find the silver lining . Spend time with those you love , eat , drink and get cooking ! Enjoy long leisurely lunches .....sleep !!!! Make the most of this crappy situation and come back better than ever . Stay strong people we got this !!! Sending you all love
15.01.2022 Daylight savings time means party time ... have you been thinking of holding a party but been overwhelmed with the thought of all the work ? Let us cater for you we do all the hard work and you get to relax and enjoy the party . We have a range of options suitable for any budget . Head over to our website for more details ... https://forkandspooncatering.com.au/ #forkandspooncatering #notaspitroastinsight #canapestyleeventssysneyandwollongong #fingerfoodcatering
15.01.2022 Madras chicken with mango chutney
14.01.2022 Have you got a pre Christmas lunch or dinner to organize but dont have the time or inclination to cook everything yourself ? Well luckily for you all we are offering all the Christmas favorites ready for you to serve to your guests . Local pick up or send us a PM to discuss delivery options .... #forkandspooncatering
13.01.2022 For all information , pricing and menus head on over to our website . https://forkandspooncatering.com.au/
13.01.2022 Sadly we have had no choice but to call it a day and take a break , this virus is not going away without us all doing our part . we will be shutting down operations so we can self isolate and take care of our family . This situation is heartbreaking and one we have not made lightly but with the current restrictions its impossible for us to continue . For those who have booked events for later in the year we will do our best to fulfill those bookings should the current ban...s be lifted . We will touch base with you all as time moves forward and those dates approach . For those who have had to postpone thank you for sticking buy us and allowing us to serve you at a later date this makes our lives that little bit easier and is the catalyst for future bookings as the vast majority of our business comes from your recommendations . We wish all our beautiful clients well and pray you stay safe in this very trying time . See you all soon xoxo Danielle and team
13.01.2022 Tonight we set up @warreenhomestead for a proposal dinner , as always the view was sensational and the homestead just breathtaking ! #weddingsillawarra #southcoastcatering #forkandspooncatering
12.01.2022 2 functions in 12 hours @ 31 weeks pregnant .... not recommended but we did it ! Now its a toastie tea & bed for me Happy first day of summer
10.01.2022 Some snaps from this weekends event , another wedding for 85 ppl and we had a blast and you could just feel the in the room . Congratulations T&J May you have many days filled with as much love as this ! #forkandspooncatering
10.01.2022 Christmas is coming ... book now to avoid disappointment .
10.01.2022 Luscious summer treats , just look at those colors !
09.01.2022 "Travel changes you. As you move through this life and this world you change things slightly, you leave marks behind, however small. And in return, life and travel leaves marks on you. Most of the time, those marks - on your body or on your heart are beautiful. Often, though, they hurt." from his book The Nasty Bits: Collected Varietal Cuts, Usable Trim, Scraps, and Bones Rest easy sir your thirst for adventure and the road less traveled has inspired countless people to explore and open our minds and hearts to others .
08.01.2022 Shut the front door ! I need these in my life now
08.01.2022 When you regret not baking extra ! #nochefsspoilsforme i could eat the face off of one of these right now . #illawarracatering
06.01.2022 Chorizo and haloumi fritters and the crowd favorite tomato and feta arancini . #keepitsimplekeepitfreshandtasty #cateringsydney #cateringillawarra
06.01.2022 We are working on a pretty special project at fork and spoon ! As some of you may already be aware we are expecting the newest member of our team late Jan 2019 . So we will be winding down at Christmas for a few months off while we settle our newest member into the world .... As in life babys can be unpredictable so we are unsure when we will be back into the swing of things completely . I will however still be around on Facebook and will consider some jobs if they are manageable with baby . So drop us a message if you have any Enquiries and we will get to them ASAP . We thank you for your understanding and look forward to working with you in the future .
06.01.2022 Todays pre Christmas lunch with all the traditional fare . Marmalade glazed ham , turkey breast with pistachio sage and cranberry stuffing with thyme roasted potato and steamed greens . Followed by a snickers cheese cake and a mango and raspberry trifle ( sorry I forgot to get a pic of that one ) ... With that our year draws to a close as we close up shop in the shire and head south for our tree change ! Dont panic we will still be servicing the Sutherland shire and Sydney metro but we plan on expanding our business to cover more of the Illawarra . We would like to wish all our loyal clients a very happy and safe festive season . May your Christmas filled with love laughter and good food . Xoxo Danielle
05.01.2022 this is so so so important ! Hospitality can be a lonely place for those who struggle daily with mental health . A fantastic step in the right direction to support our team mates . ... https://www.abc.net.au//hospo-for-life-organisat/11135692
05.01.2022 Check out these beauties ! Gifted to me by a lovely friend who is amazingly talented .... check out her page and keep her in mind you wont be disappointed . https://www.facebook.com/Bake-Spot-cookies-sweets-more-1985961431621073/
04.01.2022 Its a curl up near the fire kind of weekend ... perfect weather for a cozy dinner . #southcoastcatering #forkandspooncatering #dinnerpartycateringwollongong
04.01.2022 Post Christmas feast ..... Not a bad view either ! Maple glazed salmon Green lip mussels with cherry tomato and Israeli cous cous West Australian prawns with lime salt ... fennel, green bean and orange salad thyme roasted smashed potato coconut Panna cotta with mango and lychee See more
04.01.2022 A few snaps taken over the last three days . We had a blast catering a group getaway this weekend #southcoastweddings #foxgroundnsw #privatechefsouthcoastnsw #eagleviewpark
02.01.2022 Seriously how amazing is the Harbour !!! You can take the girl about of Sydney but you cant take Sydney out of the girl #havefoodwilltravel
02.01.2022 Probably the biggest grazing table I have done in a while . If your in the area visit Club Hillsdale such a great little club .
01.01.2022 The bun is out of the oven ! Just over a week ago miss Poppy j joined the team ... we are pretty impressed with how this one cooked up .
Related searches
- Offroad Safari Tours Australia
Businesses Tour agent Travel and transport Travel company
0402830262
388 likes
- Protein in a Box
Businesses Food & drink Health Food Shop Smoothie and juice bar Supermarket/Convenience store Health food restaurant
+61 449 957 837
145 likes