Newcastle City Farmers Market in Broadmeadow, New South Wales, Australia | Farmers market
Newcastle City Farmers Market
Locality: Broadmeadow, New South Wales, Australia
Phone: +61 427 586 079
Address: Newcastle Showground, Griffiths Road, Broadmeadow, 2292 Broadmeadow, NSW, Australia
Website: http://www.newcastlecityfarmersmarket.com.au
Likes: 30217
Reviews
to load big map
25.01.2022 Hello "The Hunter" fabulous weather forecasted this Sunday - come along & support our farmers @The Newcastle Showground, Griffiths Rd, Broadmeadow 7.00am til 1.00pm... Gladys's daughter Wendy entered the Mother's Day competition last week hoping to win the prizes for her 92 year old mum. We agree that Gladys is a very special mum and presented a stunning bouquet of flowers compliments from The Bloom Barn and soaps, candles from Candela ! Wendy & her mum spent several hours a...t the market and enjoyed a beautiful lunch together. Don't forget plenty of chef prepared food choices to be enjoyed this Sunday with the incredible Mick Jones returning this Sunday entertaining in the Food Court area @10.00am til 1.00pm. Come along and enjoy the great relaxed vibe at Newcastle City Farmers Market - Your Local Destination The Market That Cares... Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
25.01.2022 Hello Hunter Region OPEN: Sunday 8th November at The Newcastle Showground, Griffiths Rd, Broadmeadow. Growing good quality produce takes time. But don’t worry, at Newcastle City Farmers Market or any market that NSW Farmers Market operates, you will find genuine growers and food producers....Continue reading
24.01.2022 Hello Hunter Valley - come out this Sunday from 7.00am til 1.00pm at The Newcastle Showground, Broadmeadow... The farmers market is now spaced out with plenty of room to move. Grab your weekly fresh fruit, vegetables & meat - go pay a visit to the farmers' located on "Farmers Ring Road". Incredible brussel sprouts still on the stalk - just amazing. Stunning cauliflowers ready for cauliflower & leek soup with fresh bread from Bills Organics or Shepherds Bakery. Buy direct fr...om the farmer - they are always happy to answer any questions you may have. In fact they love it ! Plenty of food choices available for breakfast, brunch or lunch & of course fresh hot coffee... "Little Sprouts" playcentre is now up and running located in the undercover shed in the 3rd bay. Back by popular demand the talented "Tim Harding" located within the "Food Court" on the stage from 11.00am til 1.00pm. Take care Hunter Valley and we'll see you on Sunday ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
24.01.2022 Hello "Hunter Region" we are open this Sunday 13 June 2021 @ The Newcastle Showground, Griffiths Road, Broadmeadow 7.00am til 1.00pm... A great family day out - check out our newly refurbished area, along seating & umbrellas. Come along & support our farmers' with farm fresh produce ! Produce that actually lasts...... A vast array of food choices to be enjoyed on the day with "The Vegan Van" making its debut this Sunday - located within the food court. We now have 2 x ATM's dispensed with $20 notes for your convenience located near the demountable bathrooms. Newcastle City Farmers Market - Your Local Destination ! Keep Warm Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
24.01.2022 Hello Hunter Valley - we are open on Sunday @7.00am til 1.00pm at The Newcastle Showground, Griffiths Rd, Broadmeadow. Guess what ? Cherries will be in abundance this Sunday as we have our seasonal growers from Young attending the market. Nothing quite reminds me of Xmas like cherries. Come along & stock up on your weekly groceries, amazing produce that actually lasts...... Plenty of food choices to be enjoyed on the day - with local talent Thomas James entertaining in the "Food Court" from 10.00am. Alyssa will be helping out at "Little Sprouts" playcentre - with back to basics play, such as chalkboards, timber blocks, drawing, lego, slides among other activities. Newcastle City Farmers Market - a great place to be ! Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
24.01.2022 We are open every Sunday at The Newcastle Showground, Griffiths Road, Broadmeadow from 7.00am til 1.00pm - farm fresh produce direct from the farmer... Come visit our refreshed and revitalised farmers market including the new "Farmers Ring Road" along with the new "Food Court" complete with local professional talent playing from 11.00am til 1.00pm each week. No gimmicks, no free toys, JUST US !
24.01.2022 Hello Hunter Valley - come down to Newcastle City Farmers Market this Sunday 12 July at The Newcastle Showground, Griffiths Road, Broadmeadow from 7.00am til 1.00pm... We have a fantastic selection of farm fresh produce direct from the farmer. Come out and pick exactly what you want ! "Little Sprouts" playcentre and the undercover seating area is now open to be enjoyed.... The market has recently been revitalised and refreshed with new areas such as "Farmers Ring Road" and the very popular "Food Court". This week the fabulous Jai will be performing on the stage in the Food Court area from 11.00am til 1.00pm. Don't forget "Arts & Crafts" section is just a few steps away. Plenty of food choices available to spoil yourself along with coffee vans spread out within the market...Tibetian, French, Turkish, Dutch, Indian, Chinese, Italian plus others... Take care and see you this Sunday. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
23.01.2022 HELLO The Hunter - it's going to be a fantastic day tomorrow with beautiful weather forecasted... Come along & support our hardworking farmers - we are open @7.00am til 1.00pm at The Newcastle Showground, Broadmeadow. Tom, Clancy & Harry will be making an appearance at the market tomorrow. Had a chat this afternoon, they promised they would be on their BEST behaviour.... See you tomorrow Hunter Valley ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
21.01.2022 HELLO THE HUNTER - Come out & celebrate "Fathers Day" tomorrow at The Newcastle Showground, Broadmeadow @7.00am til 1.00pm... Experience the relaxed vibe at Newcastle City Farmers Market, grab your weekly farm fresh groceries along with a bite to eat & don't forget with have the very talented Matt McLaren playing on the stage from 10.00 til close. ATM available on the security deck for your convenience. "Little Sprouts" playcentre up and running if you need a little break.... See you tomorrow Hunter Valley... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
21.01.2022 "Taste The Difference" Hunter Valley at Newcastle City Farmers Market, The Newcastle Showground, Griffiths Rd, Broadmeadow @7.00am til 1.00pm this Sunday. Fresh seasonal produce direct from the Farmer. No wastage, produce that actually lasts... Come along and spoil yourself with plenty of food choices available. ... Back by popular demand Matt McLaren entertaining in the "Food Court" area from 10.15am til 1.15pm. Little Sprouts playcentre is up and running - thoroughly cleaned every week. Hand santiser available at all entry points for your convenience. Come and grab your weekly groceries with stalls spread out within the showground. Plenty of room - just take a leisurely stroll and enjoy your day out... Just remember if you are feeling unwell, please do not attend the market. Take care Hunter Valley and we'll see you this Sunday. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
20.01.2022 Hello "The Hunter" hope all of you beautiful "mothers" had a very special day yesterday. Anguel's fresh fruit & veggies stall had a very creative moment yesterday styling a soup pack in a stunning flower arrangement... Newcastle City Farmers Market - Your Local Destination... Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
20.01.2022 Hello Hunter Valley - A huge thank you from Newcastle City Farmers Market to our loyal customers that braved the extreme weather conditions to support our farmers... Much appreciation Kevin Eade & Jodie Lee
20.01.2022 HELLO Hunter Valley - great weather forecasted this Sunday at The Newcastle Showground, Griffiths Rd, Broadmeadow @ 7.00am til 1.00pm. Come out and grab your farm fresh weekly produce direct from the farmers. Produce that actually lasts and tastes just like it should... Have a chat to the farmers' they LOVE to chat and talk about the whole process from farm to plate. Their passion and dedication is truly heartwarming.... Pay a visit to the "Food Court" area where you can relax and enjoy the atmosphere and of course, local talent entertaining on the stage from 10.00am til 1.00pm. Sit back and be spellbound by the fabulous tones of Oran Vir. 'Little Sprouts" playcentre will open from 8.00am til 1.00pm - back to basics play, with chalk boards, cubby house, timber puzzles and blocks along with the ever popular kiddies kitchen. Our refreshed & revitalised farmers market has been spread out to making shopping even easier. Sorry no free toys only farm fresh produce !! Take care and see you this Sunday. Kevin Eade & Jodie Lee
19.01.2022 Hello Hunter Valley... Come along & support our farmers this Sunday @7.00am til 1.00pm at The Newcastle Showground, Broadmeadow... Not only the freshest seasonal produce available, but a great day out with family & friends. Plenty of room to move with entertainment every Sunday @10.00am in the "Food Court" area.... "Little Sprouts" playcentre is available if you need a little break - located in the undercover 3rd bay. Plenty of chef prepared food choices available & of course fresh hot coffee. Feel like woodfired pizza, dumplings, paella, risotto balls, big breakfast, burgers, pies, gozleme, butter chicken, bagels, among others - then we have you covered... Come along & "Taste the Difference". Take care and we'll see you this Sunday ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
19.01.2022 Newcastle City Farmers Market EVERY SUNDAY @7.00am til 1.00pm at The Newcastle Showground, Broadmeadow... Come & experience our newly revitalised & refreshed farmers market with a great relaxed vibe ! Weekly professional local talent entertaining from 10.00am in the "Food Court" area. See you on Sunday...... wwwnewcastlecityfarmersmarket.com.au
19.01.2022 Hello Hunter - come check out our newly designed farmers market this Sunday at The Newcastle Showground, Broadmeadow from 7.00am til 1.00pm. Guess What ?? Little Sprouts Playcentre is re-opening this Sunday along with the Undercover Seating area. The very popular Matt McLaren will be performing from 11.00am til 1.00pm on our new stage within the "Food Court" area...... Avocados are back in season- packed full of nutrients and antioxidants. Who doesn't love guacamole or avocado smash ! The Jazz Band is also making their return this Sunday - starting the day out entertaining within the "Farmers Ring Road". It's ALL happening at Newcastle City Farmers Market this Sunday, the fantastic vibe and atmosphere has certainly returned to the market and is here to stay ! See you on Sunday... Take care Hunter Valley Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au
18.01.2022 Hello Hunter Valley - due to weather predictions for tomorrow we have decided to close Newcastle City Farmers Market at 12.00pm this Sunday... Warmest regards Kevin Eade & Jodie Lee... www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
18.01.2022 Hello The Hunter - thank you for supporting our farmers today at Newcastle City Farmers Market... Even the wind couldn't dampen your spirits ! Another great day out at the Farmers Market.... See you on Sunday. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
17.01.2022 Hello Hunter Valley - COME & TASTE THE DIFFERENCE, we are open this Sunday at The Newcastle Showground, Griffiths Rd, Broadmeadow from 7.00am til 1.00pm... Plenty of stunning farm fresh produce all ready for you and your family this Sunday. Yes, I'm still amazed by the brussel sprouts, you will find them "fresh as fresh" on the stalk along Farmers Ring Road.... A great variety of food, coffee & tea if you feel like spoiling yourself with breakfast, brunch or lunch. Plenty of authethic fresh food cuisine made with love from the chef - French, Italian, Australian, Turkey, Tibetian, Indian, Argentinian, Egyptian, Sicilian, plus others... "Little Sprouts" playcente is up and running in the undercover area in the 3rd bay. If you need a moisturising hand sanitizer, Candela also in the 3rd bay is your go to stall. Don't forget Downtown The Duo will debuting in the Food Court area on the stage from 10.15am til 1.15pm for your entertainment. A special thanks to Renae from Spice Road (undercover area 3rd bay) for donating several rugs for the comfort of customers. We have hand sanitisers at all entry points for your convenience, remember if you are feeling unwell, please stay home ! Take care Hunter Valley & we'll see you this Sunday. Kevin Eade & Jodie Lee
16.01.2022 HELLO Hunter Valley - come out this Sunday at The Newcastle Showground, Broadmeadow @7.00am til 1.00pm... Come & experience our vibrant market - farm fresh produce direct from the farmers ! Not to mention an abundance of chef prepared food choices to tantalise your tastebuds - Argentinian, French, Tibetian, Indian, Turkish, Eyptian, Sicillian, Italian plus others "Little Sprouts" playcentre is up and running in the 3rd undercover bay, just in case you feel like a little brea...k. Our ATM service is available & can be located on the security deck near the demountable bathrooms. The fabulous Oran will be entertaining in the "Food Court" area @10.00am til 1.00pm. Does it get any better !! Take care Hunter Valley & we'll see you on Sunday Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
16.01.2022 HELLO Hunter Valley - come check out Newcastle City Farmers Market this Sunday at the Newcastle Showground, Broadmeadow trading from 7.00am til 1.00pm... Look at the farmers' incredible produce, pictures taken only last week - Brussels Sprouts sold still attached to the stalk. Absolutely spectacular to look at - located out on "Farmers Ring Road". Plenty & plenty of food choices located within the "Food Court" with the wonderful Matt McLaren entertaining the crowd from 10.30a...m til 1.30pm on our newly built stage. We reckon he sounds a bit like Elton John. Need a soothing hand santiser then go pay a visit to Candela - right next to Little Sprout playcentre, undercover area bay 3 (now up and running). The farmers market has now been spaced out throughout the large area at The Showground. Plenty of room to get around and purchase your seasonal farm fresh produce. Hand santisers at all entry points for your convenience... Take care and we'll see you this Sunday - a great day out with family and friends. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
16.01.2022 Hello Hunter Valley - see you tomorrow at the Newcastle Showground, Broadmeadow from 7.00am til 1.00pm. IS IT SOUP TIME YET ?? The farmers are all stocked and ready to trade - come check out our new revitalised and refreshed market. Stalls are spaced out throughout the market, plenty of room to move.... Crepe D'Amour, Lucy & Ben will be returning to the market tomorrow and will be located within the "Food Court". Don't forget to check out our latest Farmer - Farmer Joe, located within "Farmers Ring Road", great fresh produce. STAY TUNED - new entertainment area will be revealed next week, great local talent will perform every week from 11.00am til 1.00pm. Come and pick out exactly what you WANT ! Take care... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
14.01.2022 Hello Hunter Valley - see you tomorrow at The Newcastle Showground, Griffiths Rd, Broadmeadow @7.00am til 1.00pm. Produce of The Free Range Butcher designed & styled by JL Property Styling. Newcastle City Farmers Market - a great place to be ! Warmest regards... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
14.01.2022 Hello Hunter Valley - come check out these incredible eggs - can't believe how many are double yolks ! Eggs supplied by Michael and his crew at "Totally Free Range Eggs" located within "Farmers Ring Road", just inside the Show Ring, along with many other farmers. WHO DOESN'T LOVE dippy eggs with bread from Bills Organic Bread located in the undercover area. French Faves will be making their debut tomorrow located within the pavilion in the second bay. Plenty to choose from ...made from fresh products with a modern twist. Selection of touts, cakes, quiche lorraine, ham and cheese sandwiches with home made bread. Of course french toasties, plus more... Professional entertainment from 11.00 til 1.00pm down in the NEW food court area. Come and experience our new refreshed and revitalised farmers market, plenty of room to move. We are open from 7.00am til 1.00pm at The Newcastle Showground, Broadmeadow. See you tomorrow Hunter Valley... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
14.01.2022 Newcastle City Farmers Market every Sunday at The Newcastle Showground, Broadmeadow @7.00am til 1.00pm. Supporting our hardworking farmers !
12.01.2022 Hello - come check out our new "Revitalised & Refreshed" Farmers Market this Sunday at The Newcastle Showground, Broadmeadow from 7.00am til 1.00pm. Farmers will be ready to trade with stunning fresh produce - your favourite stalls are out and about in the newly designed layout. Just take a leisurely stroll and enjoy the fresh open air... Great seasonal vegetables such as celery, cabbage, broccoli, potatoes, radish, chinese cabbage, cauliflower, spinach, leeks, cucumbers, man...darins, lemons & oranges and of course avocados will be available. Creamy spinach, potato and bacon soup - a great family favourite. The new "Food Court" is becoming a very popular meeting place indeed. Fantastic relaxed vibe with professional musicians playing from 11.00am each week. This week we are showcasing the incredible Tim Harding...stage & all... Plenty of food choices from breakfast, brunch or lunch. Of course great coffee is always available. Almost forgot, the camels will be making an appearance this Sunday ! Tom, Clancy & Harry will be on their best behaviour (they have promised). See you on Sunday and take care. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
10.01.2022 Good Evening Hunter Valley - see you tomorrow at The Newcastle Showground, Broadmeadow @7.00am til 1.00pm. Farm fresh produce direct from the farmer ! Kevin Eade & Jodie Lee... www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
10.01.2022 Hello " The Hunter" another incredible day @ Newcastle City Farmers Market. Baby "Oli" totally enjoying himself - such a happy little man. Baby benches handmade by Rodney @ Ma & Pa's Breadboards...... We have another 5 benches on order with Rodney. See you next Sunday ! Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
09.01.2022 Hello Hunter Valley - come along & support our farmers this Sunday @7.00am til 1.00pm at The Newcastle Showground, Broadmeadow... Not only the freshest seasonal produce available, but a great day out with family & friends. Plenty of room to move with entertainment every Sunday @10.00am in the "Food Court" area. "Little Sprouts" playcentre is available if you need a little break - located in the undercover 3rd bay.... Plenty of chef prepared food choices available & of course fresh hot coffee. Feel like woodfired pizza, dumplings, paella, risotto balls, big breakfast, burgers, pies, gozleme, butter chicken, bagels, among others - then we have you covered... Come along & "Taste the Difference". Take care and we'll see you this Sunday ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
09.01.2022 Hello The Hunter - stunning weather predicted for tomorrow come along & support our hardworking farmers at The Newcastle Showground, Griffiths Rd, Broadmeadow @7.00am til 1.00pm... The farmers are ready for tomorrow with a vast array of farm fresh produce - call in for a chat, they are more than happy to answer any questions you may have. Feel like carrot juice, then pay a visit to Sam's Vegetables - the best juice available. Or maybe, orange juice prepared right before your ...eyes at Cosgrove Farm, out along Farmers Ring Road. Plenty of chef prepared food choices to be enjoyed on the day. "The Food Court" is becoming a very popular choice indeed, with local talent performing each week @ 10.00am. Our talent this week will be Max Jackson making her debut on the stage. "Little Sprouts" playcentre will be up & running @8.00am with back to basics play. Stay tuned, we have another new area being revitalised in the coming weeks, with more setting available. We are looking forward to introducing Devonshire Tea in the "Cafe Area" in the coming weeks'. Take care & we'll see you tomorrow for a fantastic day ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
09.01.2022 HELLO Hunter Valley - a revitalised and refreshed feel within the Farmers Market Community seems to have been a really fortunate consequence of these uncertain times we are living in. At a time, when so many people have suffered poor health, lost employment, lost income, and an inability to come together for life events, that were unable to go ahead. An inability to visit family and friends to care and support each other has touched us all... Our newly designed layout has be...en greeted with a very favourable response - exciting changes ahead for Newcastle City Farmers Market. A great moment captured last week from Erin & Chris - Pillidge Farm, seasonal produce available from Maitland Shire District available each week. Not to mention Erin's incredible pastes, jams and kombulcha. "Farmers Ring Road" has proven to be an enjoyable stroll (spectacular cauliflower on show, plus other incredible seasonal fruits & vegetables) - keep walking and you will be greeted with arts & crafts. Your last stop (or maybe, first stop) - our newly designed "Food Court" - plenty of choices, a great relaxed vibe for all to enjoy ! See you this Sunday 7.00am til 1.00pm at The Newcastle Showground, Broadmeadow - take care of yourself, family & friends. Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
08.01.2022 Hello "The Hunter" due to another event (Paw Patrol) being held @ The (Entertainment Centre) Newcastle Showground, we are unable to trade this Sunday 30 May 2021....... Don't worry, as we will be back trading Sunday 6 June 2021 ! Back with farm fresh produce direct from the farmers, chef prepared meals to be enjoyed on the day, plenty of seating with umbrellas, 2 x atm, playcentre, live local music & ...... "Thomas The Tank Engine" will be making an appearance 10.00am til 12.00pm free rides for our very special little ones ! Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
08.01.2022 Hello The Hunter - we have a WINNER for the Mother's Day Competition... The market will be up & running @7.00am til 1.00pm located at The Newcastle Showground, Griffiths Rd, Broadmeadow. ** The Lucky Winner is Nikia from Newcastle - thank you to all who entered the competition. Bring along your MUM tomorrow and experience the fantastic vibe at Newcastle City Farmers Market. Plenty of chef prepared food choices, freshly brewed coffee, plus live local talent from 10.00am til 1....00pm. Flowers available for your precious mum from The Bloom Barn & Kemp Creek Flowers along with huge savings off candles at Candela (located in Bay 3 undercover). Newcastle City Farmers Market - Your Local Destination Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
07.01.2022 Hello Newcastle - we are open tomorrow @7.00am til 1.00pm at The Newcastle Showground, Griffiths Rd, Broadmeadow... Come along & have a chat to Erin and her team @ Pillidge Farm, they have sensational homemade pestos, jams, marmalades and even several flavours of Kombulcha ! Also, several varieties of the versatile pumpkin - perfect for that hearty winter soup with hot sourdough bread.... See you tomorrow... Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
06.01.2022 HELLO Hunter Valley - customers are loving our redesigned and refreshed Farmers' Market. Great place for a leisurely stroll, drop in and chat to the farmers' located on "Farmers Ring Road". ** BIGGEST CHANGES IN YEARS ** We are open this Sunday at The Newcastle Showground, Broadmeadow from 7.00am til 1.00pm. ... ENTERTAINMENT has returned to the market - come down to the new "Food Court" we have professional musicians entertaining the crowds from 11.00am til 1.00pm every Sunday. We are also supporting local talent with buskers making their appearance during the early morning. The fantastic vibe of the market has certainly returned along with new exciting stalls making their debut at the market. The farmers will be stocked and ready to trade this Sunday - the soup season has arrived. Just love the cauliflower and leek soup... See you on Sunday Hunter Valley... Take care Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
06.01.2022 Hello "The Hunter" come along & support our farmers @The Newcastle Showground, Griffiths Rd, Broadmeadow 7.00am til 1.00pm this Sunday 23 May 2021. A great relaxed atmosphere with plenty of seating with umbrellas, 2 x atms, undercover playcentre and local live music from 10.00am til 1.00pm. Hot soup time has certainly arrived (we all have our favourite), pumpkin soup, cauliflower & leak soup, potato, cabbage & onion soup and one of my favourites spinach & bacon soup. Our far...mers have all the ingredients to make your heartwarming soup something special indeed... Plenty of chef prepared food choices to be enjoyed on the day - washed down with fresh hot coffee. Come along & experience our refreshed & revitalised market - something for everyone ! Newcastle City Farmers Market - Your Local Destination... Warmest regards Kevin Eade & Jodie Lee
06.01.2022 HELLO THE HUNTER - see you this Sunday at The Newcastle Showground, Griffiths Rd, Broadmeadow @7.00am til 1.00pm... Farm fresh product direct from the farmer. A great revitalised and refreshed farmers market for your enjoyment. Plenty of chef prepared food choices on the day to tantalise your tastebuds. ... Sanitise stations at all entry points for your convenience. Live music located in the "Food Court" from 10.00am til 1.00pm. Not just great farm fresh produce - but a great day out with family and friends. Take care & we'll see you this Sunday... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
06.01.2022 HELLO Hunter Valley - come out this Sunday from 7.00am til 1.00pm at The Newcastle Showground, Griffiths Rd, Broadmeadow.. Yes, another picture of brussel sprouts (couldn't help myself) they are just amazing, you can get your very own stem full of brussel sprouts out along "Farmers Ring Road". Along with plenty of other farm fresh seasonal produce for your weekly shop. The Golden Egg, Ricardos Tomatoes and Pure Local Honey produce can be found in the undercover pavillion in B...ays 1 & 2. "Little Sprouts" playcentre is now up and running - back to basics, drawing, lego, blocks, chalkboard, cubby house and kitchen. Just like yesteryear ! Our weekly entertainment is "The Afterparty Duo" located within the "Food Court" on our new stage. They will be playing from 10.30am til 1.30pm. Our farmers' market is now spread out allowing plenty of room for social distancing. Just take a leisurely stroll and you will find your favourites. Hand santisers are at all entry points for your convenience. It's going to be a great day this Sunday, come out and support our Farmers. Fantastic seasonal produce, fantastic food choices & of course a fantastic atmosphere. Take care Hunter Valley and see you on Sunday ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
05.01.2022 Hello Hunter Valley - we are open @7.00am til 1.00pm at The Newcastle Showground, Griffiths Rd, Broadmeadow this Sunday. Farm fresh produce direct from the farmer from paddock to plate. Does it get any better ? A vast array of chef prepared food choices to tempt you - go ahead and spoil yourself. After all, you deserve it !... "Little Sprouts" playcentre will be up & running with back to basics play. Due to renovations, the ATM service is now located just left of the demountable bathrooms. Come along & support our farmers - the market is well spaced out for ease of shopping. Of course, local talent will be playing in the "Food Court" area @10.00am til 1.00pm. Matt McLaren & his best friend are entertaining this Sunday (special thanks to Troy, Protein Pet) who always spoils Matt's guide dog with treats. See you this Sunday Hunter Valley ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
05.01.2022 Hello "Hunter Valley" we are BACK THIS SUNDAY @ The Newcastle Showground, Griffiths Rd, Broadmeadow - 7.00am til 1.00pm... Farm fresh produce direct from the farmer - does it get any better! Thomas The Tank Engine will be making "another" guest appearance @10.00am til 12.00pm.... FREE RIDES FOR OUR SPECIAL LITTLE ONES... Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
05.01.2022 Hello The Hunter - see you on Sunday at The Newcastle Showground, Griffiths Rd, Broadmeadow @7.00am til 1.00pm. Not only will you find the best local produce all in one place but it's the most sustainable way to support your local producers and get straight to the source with a unique opportunity to interact directly with farmers, producers & artisans. Where else but at "The Farmers" can you buy groceries direct from the farmer - from the person who grew, nurtured and made th...e product. Not only can you stock up the pantry will local sourced seasonal produce, but you can also indulge in a delicious chef prepared meal for breakfast, brunch or lunch. Newcastle City Farmers Market - a great day out ! Warmest regards Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
04.01.2022 Hello Hunter Valley - see you tomorrow at The Newcastle Showground, Broadmeadow @7.00am til 1.00pm... Grab your weekly farm fresh groceries & catch up with family & friends. A great friendly atmosphere with a relaxed vibe - easy to get around with plenty of seating for your convenience.... It's going to be a fantastic day tomorrow ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
03.01.2022 HELLO The Hunter - Fantastic weather predicted for Father's Day - Sunday 6th of September. We are open @7.00am til 1.00pm at Newcastle Showground, Griffiths Road, Broadmeadow. Come along and stock up on your weekly groceries - produce that actually lasts.... Where else can you come and speak with the farmer direct - they are always happy to answer any questions you may have. We will have entertainment in the food court area on the stage from 10.00am til 1.00pm. This area is becoming increasingly popular for varied food choices from Breakfast throught to Lunch. As always, plenty of chef prepared food choices within the "Food Court" area. Don't forget other food vendors are scattered throughout the market such as: Max & Leigha Risotto Balls, Josie Coffee, Superfood Revolution & Redbelly Gourmet all located next to Envy Horticulture & Morning Mist Bananas. It has not been an easy time to be an operator of any business and NSW Farmers Market would like to thank eveyone within our community - farmers, producers, artisans, food vendors, Venues NSW, NEC and our customers.... "YOU" have all made this time about our Community. Take Care and we'll see you this Sunday for Fathers Day ! Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
02.01.2022 Hello Hunter Valley - we are open every SUNDAY @ 7.00am til 1.00pm at Newcastle Showground, Griffiths Rd, Broadmeadow... Cherry season has finally arrived - & don't we deserve something special - watch for Tradie Produce, Young, who will soon have those beautiful large apricots on offer. The farmers' are stocked and ready to trade - where else can you speak with a grower/ producer/ artisan....and there are plenty of them at Newcastle.... Come out and bring your friends & family, not just to stock up on your weekly farm fresh groceries, but to enjoy the fabulous atmosphere on offer. Plenty of chef prepared food choices to be enjoyed on the day - along with local talent entertaining in the Food Court every Sunday @10.00am on the stage. Newcastle City Farmers Market a great place to be ! ** All photos are either taken at the market on the day or on the farmers property - NSW Farmers Market does not use stock photography. www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au Warmest regards Kevin Eade & Jodie Lee
02.01.2022 Rain, Hail or Shine Every Sunday at Newcastle Showground 7.00am till 1.00pm Did you know that all farmers markets operated by NSW Farmers Market operate Rain, Hail or Shine?... Yes farmers markets are all hip and stuff....until it rains. Every week when it is sunny people descend in droves to gather their ingredients : potatoes, fresh strawberries, kale, carrots, sweet potatoes, celery, onions, broccoli, cauliflower, fresh herbs. The farmers respond appropriately by harvesting big, hiring extra workers and hauling everything to the market site for you the customer. So what happens when it rains and people stay away? What happens is the farmers lose. A lot. And unlike a retail establishment, they can’t make up for it in the following days. (Of course, a grocery store doesn’t have to worry about the rain to begin with.) Some farmers estimate that they can lose up to 50% of their business when it rains or the weather turns inclement. But of course we cannot close because the farmers have, by Friday, picked and packed ready for Saturday and then our Sunday market for you the customer. A farmers market is much more than a place to exchange cash for goods. It’s a place of human relationships, a stage where the larger issues and values of our culture are revealed. Here we are closer to the source and therefore more responsible for and concerned about their success and well-being. In this way, we are not just consumers, we are co-producers, an important and necessary link in the important and necessary process of providing safe, sustainable and affordable food for everyone. While it’s reasonable to expect fewer customers on a day like Sunday, it was also a little disappointing to see. Yes, the weather was not so nice at times, but the camaraderie amongst the stall holders and the dedicated customers who came in dribs and drabs was heartwarming. So please, if you are committed to supporting your local farmers market remember to go to the market even on rainy days. It's only one wet day. Wear a raincoat. And like the old Led Zep song - (The Rain Song)..... Upon us all, upon us all a little rain must fall Just a little rain...... Your local farmer will be grateful for your support. www.nswfarmersmarket.com.au Our pic below is our local little buddy Archie.....taken at 2.00pm on Sunday ...."still lovin' it" and showing us there is no such thing as bad weather just unsuitable clothing.
02.01.2022 Hello "The Hunter" another fantastic day @ Newcastle City Farmers Market & the weather was kind to us. Pic compliments of Johnson's Farmgate - Over The Moon Milk, Karl & Cathy... A special mention to their dedicated team that seamlessly put together this array of farm fresh produce every Sunday. Warmest regards... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
01.01.2022 Newcastle City Farmers Market open @7.00am til 1.00pm at The Newcastle Showground, Griffiths Rd, Broadmeadow - EVERY SUNDAY...Farm fresh produce direct from the Farmer. DOES IT GET ANY FRESHER !
01.01.2022 HELLO THE HUNTER - another fantastic Sunday yesterday at Newcastle City Farmers Market. WE are open every Sunday @7.00am til 1.00pm at The Newcastle Showground, Broadmeadow... No gimmicks, no free toys, JUST US ! See you this Sunday...... Kevin Eade & Jodie Lee www.newcastlecityfarmersmarket.com.au www.nswfarmersmarket.com.au
Related searches
- New Reefs Hydroponics
Shopping & retail Farm Farmers market
+61 409 564 017
Grasstree 4740 Mackay, QLD, Australia
623 likes
-
- Dutch Pancakes
Catering van Grocers Farmers market
Anywhere 2000 The Rocks, NSW, Australia
263 likes
- Apollo Bay Farmer's Market
Community organisation Farmers market
19 - 21 Moore Street 3233 Apollo Bay, VIC, Australia
1720 likes